Encerrado

Neuro fuzzy systems

Este projeto recebeu 12 ofertas de freelancers talentosos com uma oferta média de preço de $280 USD.

Obtenha orçamentos gratuitos para um projeto como este
Empregado trabalhando
Orçamento do projeto
$30 - $250 USD
Total de Ofertas
12
Descrição do projeto

I need someone to design a neurofuzzy system for protein secondary structure prediction. Given a protein sequence it should output the secondary sequence of that protein sequence

For example if the protein sequence is KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG the secondary structure should be CCCHHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCEECCCCCCEEEEEEECCCCEECCCCEEC.

Querendo fazer dinheiro?

  • Defina seu orçamento e o prazo de entrega
  • Descreva sua proposta
  • Receba pelo seu trabalho

Contratar freelancers que também ofereça neste projeto

    • Forbes
    • The New York Times
    • Time
    • Wall Street Journal
    • Times Online